AEDG comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Stability of the tetrapeptide follows ordinary peptide chemistry rather than any unusual structural feature. The aspartate-glycine pair is prone to aspartimide formation under mildly basic or neutral conditions, and deamidation can follow, altering both mass and chromatographic retention. Dry lyophilised powder kept at or below minus twenty degrees Celsius is the usual handling recommendation, with repeated freeze-thaw cycles avoided. Once dissolved in neutral aqueous buffer, degradation proceeds over days to weeks depending on pH and temperature, while acidic conditions generally slow the aspartimide route. A formal stability-indicating study has not been published in the indexed literature.
Because epitalon has no pharmacopoeial monograph, quality assessment depends on supplier documentation and independent testing. Certificates of analysis typically report a purity figure from a single chromatographic run, a measured mass and sometimes an appearance description, but methods and acceptance criteria are not harmonised across vendors. Third-party laboratories can repeat identity and purity measurements, and mismatches between labelled and measured peptide content have been described for research peptides generally. What constitutes adequate identity confirmation for a molecule of this size stays an open question, since mass agreement alone does not separate closely related sequences.
Storage recommendations center on limiting moisture, heat, and light. The dry powder is generally kept at minus 20 degrees Celsius, and some suppliers recommend minus 80 degrees for long-term archival. Once dissolved, solutions are usually aliquoted and frozen to avoid repeated freeze-thaw cycles, which can promote aggregation or degradation. Aqueous stability depends on pH and concentration, and buffered saline is often preferred over plain water for biological work. Stability data specific to epitalon remain limited, so general peptide-handling practices are applied by analogy rather than from product-specific validation.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and its calculated monoisotopic mass is approximately 390.35 daltons. The compound does not occur naturally as a free peptide; it is produced by solid-phase peptide synthesis. Because it contains two acidic residues and no basic residues, the neutral form carries a net negative charge at physiological pH. This charge profile influences how the peptide behaves in solution and during chromatographic analysis.
| Property | Value | Notes |
|---|---|---|
| Analytical method | Reversed-phase HPLC | Purity determination, typically 214 nm |
| Mass confirmation | ESI or MALDI mass spectrometry | Compared with mass near 390 Da |
| Common synonyms | Epitalon, epithalon, AEDG | Naming differs between suppliers |
| Storage temperature | −20 °C or lower | Lyophilised powder, kept desiccated |
| Solution stability | Limited in neutral aqueous buffer | Aspartimide and hydrolysis pathways |
Typical storage for the lyophilized powder is −20 °C or lower, in a sealed container protected from light and moisture. Hygroscopic material should be allowed to equilibrate to room temperature before the vial is opened, which limits condensation on the contents. Working solutions are commonly divided into single-use aliquots and frozen to avoid repeated freeze-thaw cycles. Dilute solutions are more prone to adsorption onto plastic surfaces and to loss during filtration, so procedures that minimize transfers and use low-binding labware are preferable.
Reversed-phase high-performance liquid chromatography is the standard approach for assessing purity, usually with ultraviolet detection near 214 nm, where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the molecular mass and helps reveal truncation or deletion byproducts. Amino acid analysis can verify composition, and counterion content is sometimes measured because peptides purified with trifluoroacetic acid retain variable amounts of that salt. Purity figures reported without a stated method and detection wavelength are difficult to interpret.
In its supplied form epitalon is a white to off-white powder, usually lyophilized and often hygroscopic. It dissolves readily in water and in aqueous buffers, and it is commonly handled as the acetate or trifluoroacetate salt to improve stability during purification and drying. The amide backbone is labile in aqueous media, so solutions are less durable than the dry solid. Handling notes in the chemical literature therefore emphasize keeping the powder dry, cool and shielded from light until it is dissolved.
Epitalon is a synthetic tetrapeptide whose sequence is alanine-glutamate-aspartate-glycine, written in single-letter code as AEDG. The four residues are joined by three peptide bonds, giving a linear backbone with no branching and no disulfide bridges. Its calculated molecular mass for the free form is approximately 390.3 daltons, a figure that rises when the compound is supplied as an acetate or trifluoroacetate salt. Because the chain is short, the molecule is defined entirely by its residue order rather than by any folded three-dimensional structure.
The compound is described in the literature as a derivative of epithalamin, a preparation obtained from bovine pineal tissue. Work on this peptide family was carried out mainly by a research group in Saint Petersburg beginning in the 1980s, and the substance was later registered for clinical use in Russia under the name Epitalon. Outside that region it is generally treated as a research chemical rather than an approved medicine. Statements about its biological activity rest on a relatively small number of studies, and independent replication remains limited.
Animal and clinical reports appear mainly in Russian-language journals from the 1990s and 2000s, covering endpoints such as melatonin rhythm, lifespan in aged rodents, and retinal function. Many of these papers involve small groups, lack blinding or placebo comparison, and are difficult to retrieve through indexed databases. Review articles published in English generally summarise the claims without reanalysing the underlying data. Because no large randomised trial exists, the clinical importance of these reported effects stays unresolved and is properly described as an open question.
No national medicines regulator has approved epitalon as a therapeutic product. It is generally distributed as a research chemical, and in some jurisdictions selling peptides for human consumption without approval is restricted or prohibited. Certificates of analysis accompanying commercial material vary in which tests are performed, and independent verification of identity and purity is uncommon. Statements about anti-ageing or disease-prevention benefits on vendor pages are marketing claims rather than regulatory findings, a distinction that shapes how the compound is discussed in scientific and popular sources alike.
The most frequently cited laboratory finding is that AEDG increased telomerase activity and extended telomere length in cultured human somatic cells. That work used fetal fibroblast strains and reported changes in enzyme activity alongside altered division counts. Replication by unrelated groups has been limited, and the published record is largely a single-laboratory series rather than a multi-centre programme. The result supports a hypothesis about peptide influence on gene expression in cell culture; it does not by itself establish an effect on telomere length in living animals or in people.
== Acceptable levels of consumption == The acceptable daily intake (ADI) value for food additives, including aspartame, is defined as the "amount of a food additive, expressed on a body weight basis, that can be ingested daily over a lifetime without appreciable health risk". The Joint FAO/WHO Expert Committee on Food Additives (JECFA) and the European Commission's Scientific Committee on Food (later becoming EFSA) have determined this value is 40 mg/kg of body weight per day for aspartame, while the FDA has set its ADI for aspartame at 50 mg/kg per day – an amount equated to consuming 75 packets of commercial aspartame sweetener per day to be within a safe upper limit. The primary source for exposure to aspartame in the US is diet soft drinks, though it can be consumed in other products, such as pharmaceutical preparations, fruit drinks, and chewing gum among others in smaller quantities. A 12-US-fluid-ounce (350 ml; 12 imp fl oz) can of diet soda contains 0.18 grams (0.0063 oz) of aspartame, and, for a 75-kilogram (165 lb) adult, it takes approximately 21 cans of diet soda daily to consume the 3.7 grams (0.13 oz) of aspartame that would surpass the FDA's 50 mg/kg of body weight ADI of aspartame from diet soda alone. Studies of aspartame consumption in the US, Europe, Australia and other countries have shown that even high levels of intake are well below the ADI for safe consumption.
== Dispensing pump == Some metering pumps can be used for dispensing. A metering pump is designed to deliver a continuous rate of flow, however, a dispensing pump is designed to deliver a precise total amount.
In the chemical industry, carbon dioxide is mainly consumed as an ingredient in the production of urea, with a smaller fraction being used to produce methanol and a range of other products. Some carboxylic acid derivatives such as sodium salicylate are prepared using CO2 by the Kolbe–Schmitt reaction. Captured CO2 could be to produce methanol or electrofuels. To be carbon-neutral, the CO2 would need to come from bioenergy production or direct air capture.
A study that follows a group of people over time who have, or are at risk of developing, a specific medical condition or disease. A natural history study collects health information in order to understand how the medical condition or disease develops and how to treat it. (NCI) Study of the natural development of something (such as an organism or a disease) over a period of time. (NLM) New Drug Application (NDA)
On 12 September 2024, Paetongtarn Shinawatra and the Cabinet presented their policy statement to Parliament, outlining ten priority policies for immediate implementation. These included comprehensive debt restructuring, measures to support Thai entrepreneurs, reductions in energy and utility costs, and efforts to integrate the informal and underground economies into the tax system. Additional priorities included economic stimulus through digital wallets, modernization of the agricultural sector, tourism promotion, anti-narcotics initiatives, crime prevention, and enhancements to social welfare, particularly for vulnerable groups, stateless individuals, and ethnic minorities. Following the policy announcement, on 13 September 2024, Paetongtarn and relevant Cabinet members visited Mae Sai district, Chiang Rai, to assess the flood situation in northern Thailand.
Sources: en.wikipedia.org
Edible insects are raised as livestock in specialized insect farms. In North American as well as European countries such as the Netherlands or Belgium, insects are produced under strict food law and hygiene standards for human consumption. Conditions such as temperature, humidity, feed, water sources, and housing, vary depending on the insect species. The insects are raised from eggs to larvae status (mealworms, lesser mealworms) or to their mature form (crickets, locusts) in industrialized insect farms and then killed via temperature control. Culled insects may be freeze-dried and packed whole, or pulverized to insect powder (insect flour) to be used in other food products such as baked goods or snacks. In addition to nutritional composition and digestibility, insect species are selected for ease of rearing by the producer based on factors such as disease susceptibility, feed conversion efficiency, rate of development, and generational turnover.
== Function == Amino acid catabolism results in waste ammonia. All animals need a way to excrete this product. Most aquatic organisms, or ammonotelic organisms, excrete ammonia without converting it. Organisms that cannot easily and safely remove nitrogen as ammonia convert it to a less toxic substance, such as urea, via the urea cycle, which occurs mainly in the liver. Urea produced by the liver is then released into the bloodstream, where it travels to the kidneys and is ultimately excreted in urine. The urea cycle is essential to these organisms, because if the nitrogen or ammonia is not eliminated from the organism it can be very detrimental. In species including birds and most insects, the ammonia is converted into uric acid or its urate salt, which is excreted in solid form. Further, the urea cycle consumes acidic waste carbon dioxide by combining it with the basic ammonia, helping to maintain a neutral pH.
== Further reading == "Biographical Entry: Dr. Martin Litchfield West"[link removed], Debrett's People of Today, Debrett's Limited, 18–20 Hill Rise, Richmond, Surrey TW10 6UA United Kingdom. Fries, Almut (2015). "Martin Litchfield West (1937–2015)". Studia Metrica et Poetica. 2 (2): 152–158. doi:10.12697/smp.2015.2.2.12. ISSN 2346-6901. Lightfoot, J. L. (September 2017). "Martin Litchfield West" (PDF). Proceedings of the American Philosophical Society. 161 (3): 285–292.
White smoker vents emit lighter-hued minerals, such as those containing barium, calcium and silicon. These vents also tend to have lower-temperature plumes probably because they are generally distant from their heat source. Black and white smokers may coexist in the same hydrothermal field, but they generally represent proximal (close) and distal (distant) vents to the main upflow zone, respectively. However, white smokers correspond mostly to waning stages of such hydrothermal fields, as magmatic heat sources become progressively more distant from the source (due to magma crystallization) and hydrothermal fluids become dominated by seawater instead of magmatic water. Mineralizing fluids from this type of vent are rich in calcium and they form dominantly sulfate-rich (i.e., barite and anhydrite) and carbonate deposits.
On the other hand, inside a population, the presence of many different alleles ensures there will always be an individual with a specific MHC molecule able to load the correct peptide to recognize a specific microbe. The evolution of the MHC polymorphism ensures that a population will not succumb to a new pathogen or a mutated one, because at least some individuals will be able to develop an adequate immune response to win over the pathogen. The variations in the MHC molecules (responsible for the polymorphism) are the result of the inheritance of different MHC molecules, and they are not induced by recombination, as it is the case for the antigen receptors. Because of the high levels of allelic diversity found within its genes, MHC has also attracted the attention of many evolutionary biologists, as well as disease specialists.
Sources: en.wikipedia.org
Femen is a feminist activist group which uses topless protests as part of their campaigns against sex tourism religious institutions, sexism, and homophobia. Femen activists have been regularly detained by police in response to their protests. There is a long history of female breasts being used by comedians as a subject for comedy fodder (e.g., British comic Benny Hill's burlesque/slapstick routines).
While genetic influences are important to understanding obesity, they cannot completely explain the dramatic increase seen within specific countries or globally. Though it is accepted that energy consumption in excess of energy expenditure leads to increases in body weight on an individual basis, the cause of the shifts in these two factors on the societal scale is much debated. There are a number of theories as to the cause but most believe it is a combination of various factors. The correlation between social class and BMI varies globally. Research in 1989 found that in developed countries women of a high social class were less likely to be obese. No significant differences were seen among men of different social classes. In the developing world, women, men, and children from high social classes had greater rates of obesity. In 2007 repeating the same research found the same relationships, but they were weaker. The decrease in strength of correlation was felt to be due to the effects of globalization. Among developed countries, levels of adult obesity, and percentage of teenage children who are overweight, are correlated with income inequality. A similar relationship is seen among US states: more adults, even in higher social classes, are obese in more unequal states. Many explanations have been put forth for associations between BMI and social class.
== Post-1918 House of Hohenzollern == The German Revolution of 1918–1919 dissolved both the constituent German monarchies and the federal compact that created the office of German Emperor. Under Article 109 of the 1919 Weimar Constitution, the legal privileges of the nobility were abolished, ending the constitutional basis for individual monarchical titles and eliminating the legal basis for the imperial federal office. For their part, in late 1918, both Wilhelm II and his heir formally renounced all succession rights. In his formal deed of abdication signed at Amerongen on 28 November 1918, Wilhelm II declared that he renounced "for all time claims to the throne of Prussia and to the German Imperial throne connected therewith." Crown Prince Wilhelm similarly executed a deed of renunciation on 1 December 1918, forfeiting his succession rights to both the Prussian and imperial crowns. After 1918, the House of Hohenzollern continued to use its traditional dynastic house laws primarily to govern the succession of family trusts and private estate inheritance. In 2004, the Federal Constitutional Court of Germany confirmed that these historical house laws possess no public-law standing and operate strictly within the framework of private civil law, with headship of the family functioning as a private lineage rather than a constitutional office.
=== Europe === A marketing authorisation application for 68Ga-PSMA-11 (INN Gallium (68Ga) gozetotide), under the brand name Illucix, was made to the Danish Medicines Agency, on behalf of several EU countries and the UK. Approval is expected in 2022. In 2022 a marketing authorisation application was made by the manufacturer of 18F-DCFPyL (branded Pylclari) to the European Medicines Agency. Polish manufacturer and distributor of radiopharmaceutical procuts, Polatom, has been granted a US patent for a 99mTc-PSMA-T4 kit. In the UK, Tc-99m labelled PSMA has product authorisation but lacks funding.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
The molecule lacks aromatic residues, so it absorbs weakly near 280 nanometres, the wavelength applied to many other peptides. The peptide bond absorbs strongly below 220 nanometres, making 214 nanometres a practical compromise. Gradient methods must therefore use mobile phases with low ultraviolet absorbance to keep the baseline clean.
Neutral and slightly basic aqueous conditions promote aspartimide formation at the aspartate-glycine step, often followed by deamidation. Elevated temperature and repeated freeze-thaw cycles accelerate the loss. Acidic solutions and dry lyophilised powder are comparatively stable over short periods.
No monograph exists in the United States Pharmacopeia or the European Pharmacopoeia, and no widely distributed certified reference standard is available. Purity and identity therefore rest on supplier methods that are not harmonised. This absence is the main reason reported purities are difficult to compare between sources.
Epitalon is a synthetic tetrapeptide built from four amino acids: alanine, glutamate, aspartate, and glycine. It is not extracted from a natural source but made in the laboratory by chemical synthesis. Its short length makes it relatively straightforward to produce at high purity.